PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00090.1.g00750.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 903aa    MW: 95190.1 Da    PI: 11.0174
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00090.1.g00750.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.54e-17727781256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Zpz_sc00090.1.g00750.1.am.mk 727 RKKLRLSKEQSAFLEESFKEHATLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 781
                                   788899***********************************************98 PP

2HD-ZIP_I/II124.45.2e-40727817192
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlskeq+++LEesF+e+ +L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+
  Zpz_sc00090.1.g00750.1.am.mk 727 RKKLRLSKEQSAFLEESFKEHATLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQ 807
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelk 92 
                                   ke +eLr +lk
  Zpz_sc00090.1.g00750.1.am.mk 808 KELAELR-ALK 817
                                   ******9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-17713777IPR009057Homeodomain-like
SuperFamilySSF466896.42E-18714784IPR009057Homeodomain-like
PROSITE profilePS5007117.086723783IPR001356Homeobox domain
SMARTSM003897.4E-16725787IPR001356Homeobox domain
CDDcd000861.20E-16727784No hitNo description
PfamPF000461.4E-14727781IPR001356Homeobox domain
PROSITE patternPS000270758781IPR017970Homeobox, conserved site
PfamPF021834.3E-10783817IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.5E-24783826IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 903 aa     Download sequence    Send to blast
MLTQAPSQMA PLPNYSSHAK RARSKGLRQG MTGPQPSCRR RCGGATCSLS TGAIALLVKA  60
SHAARNDSTK SSTLSTPALI ASQKQGCSLI ASWPKAGRRA GELVLGEEKP QHAAGNHGDI  120
IAGAAPNDCA WRAVGTRGAA QEWVIALARL VRPSGMLCSP DTDQWLGAPC SQSTGTLHRS  180
VRIPLTPTSR AVTSPRGAVL WPLIGDPAMG RARAKCHCRV LAFTIRGPRP CPPSRVTCAP  240
LRRRRRWSSG PVVLLLRPLW SASPLTSRRP CPHQCLVDRG HERLIASVTS IIAVAHHRRG  300
GARRPDGALV SGDVEYSSVL ADAAILVLLP KAPPGAIPPI HPSAPGRGST ARADVAGAGD  360
SVMRNVGREP AGRGACAVLP SRPMNFPGAA AFTALRTRHV TSSGGGAAGA PRPGHGRHAA  420
GATREGGVWL EAGWVALLAC PSPACRSSPQ VWHSISIRHT VTDDPVTNRR PSSPPSWRGR  480
ASRQQRSSSG PCSIASLLPG PRQPVKRTII TGTHTSAAGG EPESRPPCHA GAIKPRGPCE  540
FRRLHYRFLG PGRMELGLSL RDTMADAGRD LVLGLGMGMG VVGRQDEGGE RRSKRDREEA  600
ASPARMEPEL GAGRCRRSSP EPPARLTLLS MVPSLGLPWP SPDTGHLGAS TRGFDVNRAP  660
SCAAGAAGEE DEEQDDAGAG GAAVSSSPNN SAGSFPTDFS ARGQTVPGGG DRACSRASDE  720
DDGGSSRKKL RLSKEQSAFL EESFKEHATL NPKQKLALAK QLNLRPRQVE VWFQNRRART  780
KLKQTEVDCE YLKRCCETLT EENRRLQKEL AELRALKTVN PFYMHLPATT LSMCPSCERV  840
ASTNSAAASG ASAPQQATTP ARPPSSGGIG DSAPDPRPSS FAALFSSPLK RPLAAQPQAP  900
ASS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1725731SRKKLRL
2775783RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0364470.0BT036447.1 Zea mays full-length cDNA clone ZM_BFb0114O05 mRNA, complete cds.
GenBankKJ7269110.0KJ726911.1 Zea mays clone pUT3456 HB transcription factor (HB11) mRNA, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-60homeobox from Arabidopsis thaliana